| request information: |
|
| Catalog Code: | H00010142-M01 |
| Product Name: | AKAP9 Antibody |
| Product Description: | Mouse Monoclonal anti-AKAP9 (1A6) |
| Clone: | 1A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10142 |
| Gene Symbol: | AKAP9 |
| Omim ID: | 604001, |
| Immunogen: | AKAP9 (NP_671700, 3812 a.a. ~ 3912 a.a) partial recombinant protein with GST tag. |
| Epitope: | EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEAL
QRRLGTIQSGSTTQFHAGMRR* |
| Specificity: | AKAP9 - A kinase (PRKA) anchor protein (yotiao) 9 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AKAP9 antibody, anti-PRKA9 antibody, anti-CG-NAP antibody, anti-YOTIAO antibody, anti-AKAP350 antibody, anti-AKAP450 antibody, anti-HYPERION antibody, anti-KIAA0803 antibody, anti-A kinase (PRKA) anchor protein (yotiao) 9 antibody, anti-AKAP120-like protein antibody, anti-kinase N-associated protein antibody, anti-A-kinase anchoring protein 450 antibody, anti-A-kinase anchor protein antibody, anti-350kDa antibody, anti-protein kinase A anchoring p Official Symbol antibody, anti-AKAP9 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|