| CatalogCode: | H00010141-M01 |
| ProductName: | C4orf6 Antibody |
| Product Description: | Mouse Monoclonal anti-C4orf6 (3F12) |
| Clone: | 3F12 |
| Clonality: | Monoclonal |
| Immunogen: | C4orf6 (NP_005741, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. |
| Epitope: | MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ* ... |
| Specificity: | C4orf6 - chromosome 4 open reading frame 6 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-aC1 antibody |
| ProteinTarget: | C4orf6 - chromosome 4 open reading frame 6 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10141 |
| Gene_Symbol: | C4orf6 |
order or
more information: | company product webpage |
| request information: |
|