ExactAntigen

BCAP31 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010134-M01
Product Type:Primary Antibody
Product Name:BCAP31 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10134
Host:Mouse
Clone:3C5
Product Description:Mouse Monoclonal anti-BCAP31 (3C5)
Species Summary:Hu
Background:BCAP31 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.
Alternate Names:anti-B-cell receptor-associated protein 31 antibody
Immunogen:BCAP31 (NP_005736, 137 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Epitope:KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE* ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 ml protein A purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:BCAP31
Omim ID:300398,
see all human BCAP31 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about