| request information: |
|
| Catalog Code: | H00010106-A01 |
| Product Name: | CTDSP2 Antibody |
| Product Description: | Mouse Polyclonal anti-CTDSP2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10106 |
| Gene Symbol: | CTDSP2 |
| Omim ID: | 608711, |
| Immunogen: | CTDSP2 (NP_005721, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQ
YQFYQIPGTCLLPEVTEEDQ* |
| Specificity: | CTDSP2 - CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-OS4 antibody, anti-PSR2 antibody, anti-SCP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |