| request information: |
|
| Catalog Code: | H00010097-A01 |
| Product Name: | ACTR2 Antibody |
| Product Description: | Mouse Polyclonal anti-ACTR2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10097 |
| Gene Symbol: | ACTR2 |
| Omim ID: | 604221 |
| Immunogen: | ACTR2 (AAH14546, 1 a.a. ~ 395 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTLEVNYPMENGIV
RNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVD
SGDGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALET
TVLVESYTLPDGRIIKVG |
| Specificity: | ACTR2 - ARP2 actin-related protein 2 homolog (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |