| request information: |
|
| Catalog Code: | H00010087-A01 |
| Product Name: | COL4A3BP Antibody |
| Product Description: | Mouse Polyclonal anti-COL4A3BP |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10087 |
| Gene Symbol: | COL4A3BP |
| Omim ID: | 604677 |
| Immunogen: | COL4A3BP (NP_112729, 499 a.a. ~ 599 a.a) partial recombinant protein with GST tag. |
| Epitope: | TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYP
KFLKRFTSYVQEKTAGKPILF* |
| Specificity: | COL4A3BP - collagen, type IV, alpha 3 (Goodpasture antigen) binding protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GPBP antibody, anti-Collagen type IV binding protein antibody, anti-StARD11 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |