ExactAntigen

PQBP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010084-A01
Product Type:Primary Antibody
Product Name:PQBP1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:10084
Host:Mouse
Product Description:Mouse Polyclonal anti-PQBP1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999).[supplied by OMIM] PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be exten
Alternate Names:anti-MRX55 antibody, anti-MRXS3 antibody, anti-MRXS8 antibody, anti-NPW38 antibody, anti-RENS1 antibody, anti-SHS antibody
Immunogen:PQBP1 (NP_005701, 184 a.a. ~ 266 a.a) partial recombinant protein with GST tag.
Epitope:LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant PQBP1.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PQBP1
Omim ID:300463, 309500,
see all human PQBP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about