| Catalog Code: | H00010084-A01 |
| Product Type: | Primary Antibody |
| Product Name: | PQBP1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 10084 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-PQBP1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999).[supplied by OMIM] PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be exten |
| Alternate Names: | anti-MRX55 antibody, anti-MRXS3 antibody, anti-MRXS8 antibody, anti-NPW38 antibody, anti-RENS1 antibody, anti-SHS antibody |
| Immunogen: | PQBP1 (NP_005701, 184 a.a. ~ 266 a.a) partial recombinant protein with GST tag. |
| Epitope: | LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant PQBP1. |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PQBP1 |
| Omim ID: | 300463, 309500, |