| request information: |
|
| Catalog Code: | H00010073-M01 |
| Product Name: | RNUT1 Antibody |
| Product Description: | Mouse Monoclonal anti-RNUT1 (2B2-1B4) |
| Clone: | 2B2-1B4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10073 |
| Gene Symbol: | RNUT1 |
| Omim ID: | 607902 |
| Immunogen: | RNUT1 (AAH04203, 1 a.a. ~ 361 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSE RRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDE EMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPV GKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKD YTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHS KLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDV |
| Specificity: | RNUT1 - RNA, U transporter 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SNURPORTIN1 antibody, anti-KPNBL antibody, anti-RNA U transporter 1 antibody, anti-RNUT1 antibody, anti-Snurportin 1 antibody, anti-Snurportin1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |