| request information: |
|
| Catalog Code: | H00010062-M01 |
| Product Name: | NR1H3 Antibody |
| Product Description: | Mouse Monoclonal anti-NR1H3 (3D12-C6) |
| Clone: | 3D12-C6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10062 |
| Gene Symbol: | NR1H3 |
| Omim ID: | 602423 |
| Immunogen: | NR1H3 (AAH08819, 1 a.a. ~ 388 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILRE EARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKR KKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSV IKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECV LSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ LGMIEKLVAAQQQCNRRSFSDRLRVTVMLLETSRR |
| Specificity: | NR1H3 - nuclear receptor subfamily 1, group H, member 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | Liver X receptors (LXRs), also known as RLD1, are oxysterol activated nuclear receptors which are involved in the regulation of genesis and metabolism of cholesterols and bile acids. LXRs form heterodimeric complexes with the retinoic acid receptors (RARs) once activated by their respective oxysterol ligands. Two known isoforms, alpha and beta, are differentially expressed; the alpha isoform predominantly expressed in liver, whereas beta isoform expression has been shown to be ubiquitous. Liver X Receptors (LXRs) are oxysterol activated nuclear receptors which are involved in the regulation of genesis and metabolism of cholesterols and bile acids. LXRs form heterodimeric complexes with the retinoic acid receptors (RARs) once activated by their respective oxysterol ligands. Two known isoforms, alpha and beta, are differentially expressed; the alpha isoform predominantly expressed in liver, whereas beta isoform expression has been shown to be ubiquitous. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgM kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LXR alpha antibody, anti-Liver X receptor alpha antibody, anti-LXR a antibody, anti-LXRA antibody, anti-NR1H3 antibody, anti-Nuclear orphan receptor LXR alpha antibody, anti-Nuclear receptor subfamily 1 group H member 3 antibody, anti-Oxysterols receptor LXR alpha antibody, anti-RLD 1 antibody, anti-RLD1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |