ExactAntigen

ABCF2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010061-M01
Product Type:Primary Antibody
Product Name:ABCF2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10061
Host:Mouse
Clone:1D11
Isotype:IgG2a kappa
Product Description:Mouse Monoclonal anti-ABCF2 (1D11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = ABCF2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-ABC28 antibody, anti-DKFZp586K1823 antibody, anti-EST133090 antibody, anti-HUSSY-18 antibody, anti-M-ABC1 antibody
Immunogen:ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS ...
Specificity:ABCF2 - ATP-binding cassette, sub-family F (GCN20), member 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ABCF2
see all human ABCF2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about