ExactAntigen

Mouse Polyclonal anti-ABCF2 - ATP-binding cassette, sub-family F (GCN20), member 2, MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00010061-B01
ProductName:ABCF2 Antibody
Product Description:Mouse Polyclonal anti-ABCF2 - ATP-binding cassette, sub-family F (GCN20), member 2, MaxPab Antibody
Clonality:Polyclonal
Immunogen:ABCF2 (NP_009120, 1 a.a. ~ 623 a.a) full-length human protein.
Epitope:MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEP ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot.
Background:The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-ABC28 antibody, anti-DKFZp586K1823 antibody, anti-EST133090 antibody, anti-HUSSY-18 antibody, anti-M-ABC1 antibody
ProteinTarget:ATP-binding cassette, sub-family F (GCN20), member 2
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:10061
Gene_Symbol:ABCF2
see all human ABCF2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about