| request information: |
|
| Catalog Code: | H00010059-M01 |
| Product Name: | DNM1L Antibody |
| Product Description: | Mouse Monoclonal anti-DNM1L (3B5) |
| Clone: | 3B5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10059 |
| Gene Symbol: | DNM1L |
| Omim ID: | 603850 |
| Immunogen: | DNM1L (AAH24590, 1 a.a. ~ 711 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTT
GEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQ
PKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPV
KLGIIGVVNRSQLDINNK |
| Specificity: | DNM1L - dynamin 1-like |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DLP1 antibody, anti-DRP1 antibody, anti-DVLP antibody, anti-DYMPLE antibody, anti-HDYNIV antibody, anti-VPS1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |