| request information: |
|
| Catalog Code: | H00010056-A02 |
| Product Name: | FARSLB Antibody |
| Product Description: | Mouse Polyclonal anti-FARSLB |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10056 |
| Gene Symbol: | FARSLB |
| Immunogen: | FARSLB (NP_005678, 234 a.a. ~ 342 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRAD
LINKKVGIRETPENLAKLLTRMYLKSEVI* |
| Specificity: | FARSLB - phenylalanine-tRNA synthetase-like, beta subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FRSB antibody, anti-PheHB antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |