ExactAntigen

SH2D3C Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00010044-M07
Product Name:SH2D3C Antibody
Product Description:Mouse Monoclonal anti-SH2D3C (3C5)
Clone:3C5
Clonality:Monoclonal
ListPrice:295
Gene ID:10044
Gene Symbol:SH2D3C
Omim ID:604722,
Immunogen:SH2D3C (NP_005480, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQR
NGDFLIRDSLTSLGDYVLTCRWRNQALHFKI*
Specificity:SH2D3C - SH2 domain containing 3C
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 kappa
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CHAT antibody, anti-NSP3 antibody, anti-PRO34088 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human SH2D3C antibodies


2008©ExactAntigen home | browse | about