| request information: | |
| Catalog Code: | H00010044-M05 |
| Product Name: | SH2D3C Antibody |
| Product Description: | Mouse Monoclonal anti-SH2D3C (2G1) |
| Clone: | 2G1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10044 |
| Gene Symbol: | SH2D3C |
| Omim ID: | 604722, |
| Immunogen: | SH2D3C (NP_005480, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQR NGDFLIRDSLTSLGDYVLTCRWRNQALHFKI* |
| Specificity: | SH2D3C - SH2 domain containing 3C |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CHAT antibody, anti-NSP3 antibody, anti-PRO34088 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |