| request information: |
|
| Catalog Code: | H00010015-M01 |
| Product Name: | PDCD6IP Antibody |
| Product Description: | Mouse Monoclonal anti-PDCD6IP (3C4) |
| Clone: | 3C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10015 |
| Gene Symbol: | PDCD6IP |
| Omim ID: | 608074 |
| Immunogen: | PDCD6IP (AAH20066, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIE
PKFPFSENQICLTFTWKDAFDKGSLFGGSVK |
| Specificity: | PDCD6IP - programmed cell death 6 interacting protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AIP1 antibody, anti-Alix antibody, anti-DRIP4 antibody, anti-HP95 antibody, anti-MGC17003 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |