| CatalogCode: | H00010015-B02 |
| ProductType: | Primary Antibody |
| ProductName: | PDCD6IP Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 10015 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-PDCD6IP - programmed cell death 6 interacting protein, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a prot |
| ALTnames: | anti-AIP1 antibody, anti-Alix antibody, anti-DRIP4 antibody, anti-HP95 antibody, anti-MGC17003 antibody |
| Immunogen: | PDCD6IP (NP_037506, 1 a.a. ~ 868 a.a) full-length human protein. |
| Epitope: | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQAN ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |