ExactAntigen

potassium voltage-gated channel, Isk-related family, member 2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009992-A01
Product Name:potassium voltage-gated channel, Isk-related family, member 2 Antibody
Product Description:Mouse Polyclonal anti-potassium voltage-gated channel, Isk-related family, member 2
Clonality:Polyclonal
ListPrice:225
Gene ID:9992
Gene Symbol:KCNE2
Omim ID:603796, 607554,
Immunogen:KCNE2 (NP_751951, 73 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Epitope:KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP*
Specificity:potassium voltage-gated channel, Isk-related family, member 2
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested.
Background:Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-LQT5 antibody, anti-LQT6 antibody, anti-MGC138292 antibody, anti-MIRP1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human KCNE2 antibodies


2008©ExactAntigen home | browse | about