| request information: |
|
| Catalog Code: | H00009991-M01 |
| Product Name: | ROD1 Antibody |
| Product Description: | Mouse Monoclonal anti-ROD1 (4C9) |
| Clone: | 4C9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9991 |
| Gene Symbol: | ROD1 |
| Omim ID: | 607527, |
| Immunogen: | ROD1 (NP_005147, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. |
| Epitope: | GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGK
SQAFLEMASEEAAVTMVNYY* |
| Specificity: | ROD1 - ROD1 regulator of differentiation 1 (S. pombe) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | ROD1 is a functional homolog of nrd1, an S. pombe RNA-binding protein that suppresses the onset of differentiation.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp781I1117 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |