| request information: |
|
| Catalog Code: | H00009968-A01 |
| Product Name: | MED12 Antibody |
| Product Description: | Mouse Polyclonal anti-MED12 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9968 |
| Gene Symbol: | MED12 |
| Omim ID: | 300188 |
| Immunogen: | MED12 (NP_005111, 1829 a.a. ~ 1942 a.a) partial recombinant protein with GST tag. |
| Epitope: | QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRP
TYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP* |
| Specificity: | MED12 - mediator of RNA polymerase II transcription, subunit 12 homolog (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAGH45 antibody, anti-HOPA antibody, anti-KIAA0192 antibody, anti-OPA1 antibody, anti-TNRC11 antibody, anti-TRAP230 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |