| request information: |
|
| Catalog Code: | H00009869-A01 |
| Product Name: | SETDB1 Antibody |
| Product Description: | Mouse Polyclonal anti-SETDB1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9869 |
| Gene Symbol: | SETDB1 |
| Omim ID: | 604396 |
| Immunogen: | SETDB1 (NP_036564, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | SSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQ
LFDDASRAVTNCESLVKDFY* |
| Specificity: | SETDB1 - SET domain, bifurcated 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The SET domain is a highly conserved, approximately 150-amino acid motif implicated in the modulation of chromatin structure. It was originally identified as part of a larger conserved region present in the Drosophila Trithorax protein and was subsequently identified in the Drosophila Su(var)3-9 and 'Enhancer of zeste' proteins, from which the acronym SET is derived. Studies have suggested that the SET domain may be a signature of proteins that modulate transcriptionally active or repressed chromatin states through chromatin remodeling activities.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ESET antibody, anti-KG1T antibody, anti-KIAA0067 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |