| request information: |
|
| Catalog Code: | H00009863-M01 |
| Product Name: | MAGI2 Antibody |
| Product Description: | Mouse Monoclonal anti-MAGI2 (6C8) |
| Clone: | 6C8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9863 |
| Gene Symbol: | MAGI2 |
| Omim ID: | 606382, |
| Immunogen: | MAGI2 (NP_036433, 519 a.a. ~ 629 a.a) partial recombinant protein with GST tag. |
| Epitope: | PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSG
ATQAELMTLTIVKGAQGFGFTIADSPTGQRV* |
| Specificity: | MAGI2 - membrane associated guanylate kinase, WW and PDZ domain containing 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ACVRIP1 antibody, anti-AIP1 antibody, anti-ARIP1 antibody, anti-MAGI-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |