| request information: |
|
| Catalog Code: | H00009863-A01 |
| Product Name: | MAGI2 Antibody |
| Product Description: | Mouse Polyclonal anti-MAGI2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9863 |
| Gene Symbol: | MAGI2 |
| Omim ID: | 606382 |
| Immunogen: | MAGI2 (NP_036433, 519 a.a. ~ 629 a.a) partial recombinant protein with GST tag. |
| Epitope: | PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSG
ATQAELMTLTIVKGAQGFGFTIADSPTGQRV* |
| Specificity: | MAGI2 - membrane associated guanylate kinase, WW and PDZ domain containing 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACVRIP1 antibody, anti-AIP1 antibody, anti-ARIP1 antibody, anti-MAGI-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |