ExactAntigen

PSMD6 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009861-A01
Product Name:PSMD6 Antibody
Product Description:Mouse Polyclonal anti-PSMD6
Clonality:Polyclonal
ListPrice:225
Gene ID:9861
Gene Symbol:PSMD6
Immunogen:PSMD6 (NP_055629, 292 a.a. ~ 390 a.a) partial recombinant protein with GST tag.
Epitope:YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETI
KKGDLLLNRVQKLSRVINM*
Specificity:PSMD6 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-KIAA0107 antibody, anti-S10 antibody, anti-SGA-113M antibody, anti-p44S10 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human p44S10 antibodies


2008©ExactAntigen home | browse | about