| request information: |
|
| Catalog Code: | H00009843-A01 |
| Product Name: | hephaestin Antibody |
| Product Description: | Mouse Polyclonal anti-hephaestin |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9843 |
| Gene Symbol: | HEPH |
| Omim ID: | 300167, |
| Immunogen: | HEPH (NP_620074, 315 a.a. ~ 425 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDY
GPMGHDGSTGKNLREPGSISDKFFQKSSSRI* |
| Specificity: | hephaestin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | The protein encoded by this gene is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Two transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CPL antibody, anti-KIAA0698 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |