| request information: |
|
| Catalog Code: | H00009815-A02 |
| Product Name: | GIT2 Antibody |
| Product Description: | Mouse Polyclonal anti-GIT2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9815 |
| Gene Symbol: | GIT2 |
| Omim ID: | 608564, |
| Immunogen: | GIT2 (NP_055591, 401 a.a. ~ 499 a.a) partial recombinant protein with GST tag. |
| Epitope: | TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMG
EASRPEESRMRLQPFPAHA* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant GIT2. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the GIT protein family. GIT proteins interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. This gene undergoes extensive alternative splicing; although ten transcript variants have been described, the full length sequence has been determined for only four variants. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAT2 antibody, anti-DKFZp686G01261 antibody, anti-KIAA0148 antibody, anti-MGC760 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |