| request information: |
|
| Catalog Code: | H00009815-A01 |
| Product Name: | GIT2 Antibody |
| Product Description: | Mouse Polyclonal anti-GIT2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9815 |
| Gene Symbol: | GIT2 |
| Omim ID: | 608564 |
| Immunogen: | GIT2 (AAH01379, 1 a.a. ~ 472 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNNGANSIWEHS
LLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQ
ANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGR
KPDHKNGQHFIIPQMADS |
| Specificity: | GIT2 - G protein-coupled receptor kinase interactor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the GIT protein family. GIT proteins interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. This gene undergoes extensive alternative splicing; although ten transcript variants have been described, the full length sequence has been determined for only four variants. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAT-2 antibody, anti-DKFZp686G01261 antibody, anti-KIAA0148 antibody, anti-MGC760 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |