| request information: |
|
| Catalog Code: | H00009768-M01 |
| Product Name: | KIAA0101 Antibody |
| Product Description: | Mouse Monoclonal anti-KIAA0101 (3C11-1F11) |
| Clone: | 3C11-1F11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9768 |
| Gene Symbol: | KIAA0101 |
| Immunogen: | KIAA0101 (AAH05832, 1 a.a. ~ 112 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRK AENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPE EAGSSGLGKAKRKACPLQPDHTNDEKE* |
| Specificity: | KIAA0101 - KIAA0101 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Mitochondrial and Nuclear |
| Background: | KIAA0101/NS5ATP9/PAF/p15(PAF) is involved in protection of cells from UV-induced cell death and is also a Hepatitis C NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-L5 antibody, anti-PAF antibody, anti-HCV NS5A transactivated protein 9 antibody, anti-Hepatitis C virus NS5A transactivated protein 9 antibody, anti-NS5 ATP9 antibody, anti-NS5ATP9 antibody, anti-OEATC 1 antibody, anti-Overexpressed in anaplastic thyroid carcinoma 1 antibody, anti-p15(PAF) antibody, anti-p15PAF antibody, anti-PCNA associated factor antibody, anti-PCNA-associated factor antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Yuan, R.H.,et al. Overexpression of KIAA0101 Predicts High Stage, Early Tumor Recurrence, and Poor Prognosis of Hepatocellular Carcinoma. Clin Cancer Res. 2007 Sep 15;13(18):5368-76. |
order or
more information: | company product webpage |