| request information: |
|
| Catalog Code: | H00009706-M04 |
| Product Name: | ULK2 Antibody |
| Product Description: | Mouse Monoclonal anti-ULK2 (1A1) |
| Clone: | 1A1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9706 |
| Gene Symbol: | ULK2 |
| Omim ID: | 608650, |
| Immunogen: | ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag. |
| Epitope: | FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGA EAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDT LRHLNVMLMFTECVLDL |
| Specificity: | ULK2 - unc-51-like kinase 2 (C. elegans) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA0623 antibody, anti-Serine/threonine protein kinase ULK2 antibody, anti-Unc 51 like kinase 2 antibody, anti-Unc51.2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |