ExactAntigen

Mouse Monoclonal anti-ULK2 (6E4) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00009706-M03
ProductName: ULK2 Antibody
Product Description: Mouse Monoclonal anti-ULK2 (6E4)
Clone: 6E4
Clonality: Monoclonal
Immunogen: ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag.
Epitope: FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL ...
Specificity: ULK2 - unc-51-like kinase 2 (C. elegans)
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG Mix Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-KIAA0623 antibody, anti-Unc51.2 antibody
ProteinTarget: ULK2 - unc-51-like kinase 2 (C. elegans)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 9706
Gene_Symbol: ULK2
Omim_ID: 608650,
more information: company product webpage
Also see:
see all human ULK2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about