| request information: |
|
| Catalog Code: | H00009669-A01 |
| Product Name: | EIF5B Antibody |
| Product Description: | Mouse Polyclonal anti-EIF5B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9669 |
| Gene Symbol: | EIF5B |
| Omim ID: | 606086 |
| Immunogen: | EIF5B (NP_056988, 1121 a.a. ~ 1219 a.a) partial recombinant protein with GST tag. |
| Epitope: | QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFR
DEMQKSDWQLIVELKKVFE* |
| Specificity: | EIF5B - eukaryotic translation initiation factor 5B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434I036 antibody, anti-FLJ10524 antibody, anti-IF2 antibody, anti-KIAA0741 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. de Breyne S, Bonderoff JM, Chumakov KM, et al. Cleavage of eukaryotic initiation factor eIF5B by enterovirus 3C proteases. Virology. 2008 Jun 20. |
order or
more information: | company product webpage |