| request information: | |
| Catalog Code: | H00009647-M01 |
| Product Name: | PPM1F Antibody |
| Product Description: | Mouse Monoclonal anti-PPM1F (2A9) |
| Clone: | 2A9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9647 |
| Gene Symbol: | PPM1F |
| Immunogen: | PPM1F (NP_055449, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAAL AHEAVSQLLQTDLSEFRKLPR* |
| Specificity: | PPM1F - protein phosphatase 1F (PP2C domain containing) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-CaMKPase antibody, anti-FEM-2 antibody, anti-KIAA0015 antibody, anti-POPX2 antibody, anti-hFEM-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |