ExactAntigen

PPM1F Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009647-B01
Product Name:PPM1F Antibody
Product Description:Mouse Polyclonal anti-PPM1F - protein phosphatase 1F (PP2C domain containing), MaxPab Antibody
Clonality:Polyclonal
ListPrice:295
Gene ID:9647
Gene Symbol:PPM1F
Immunogen:PPM1F (NP_055449, 1 a.a. ~ 454 a.a) full-length human protein.
Epitope:MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAAL
AHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVS
IHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRR
TDQMFLRKAKRERLQSGT
Cross Reactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA.
Background:The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:ELISA, immunofluorescence, Western Blot
Species Summary:Hu
Alternate Names:anti-CaMKPase antibody, anti-FEM-2 antibody, anti-KIAA0015 antibody, anti-POPX2 antibody, anti-hFEM-2 antibody
Package Size:0.05 ml
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human PPM1F antibodies


2008©ExactAntigen home | browse | about