| request information: | |
| Catalog Code: | H00009641-M03 |
| Product Name: | IKBKE Antibody |
| Product Description: | Mouse Monoclonal anti-IKBKE (2B6) |
| Clone: | 2B6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9641 |
| Gene Symbol: | IKBKE |
| Omim ID: | 605048, |
| Immunogen: | IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. |
| Epitope: | QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRN HLRLVGCSVAACNTEAQGVQE |
| Specificity: | IKBKE - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-IKK-i antibody, anti-IKKE antibody, anti-IKKI antibody, anti-KIAA0151 antibody, anti-MGC125294 antibody, anti-MGC125295 antibody, anti-MGC125297 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |