ExactAntigen

IKBKE Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009641-M03
Product Name:IKBKE Antibody
Product Description:Mouse Monoclonal anti-IKBKE (2B6)
Clone:2B6
Clonality:Monoclonal
ListPrice:295
Gene ID:9641
Gene Symbol:IKBKE
Omim ID:605048,
Immunogen:IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag.
Epitope:QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRN
HLRLVGCSVAACNTEAQGVQE
Specificity:IKBKE - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host Name:Mouse
Application Summary:ELISA
Species Summary:Hu
Alternate Names:anti-IKK-i antibody, anti-IKKE antibody, anti-IKKI antibody, anti-KIAA0151 antibody, anti-MGC125294 antibody, anti-MGC125295 antibody, anti-MGC125297 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human IKBKE antibodies


2008©ExactAntigen home | browse | about