ExactAntigen

FEZ1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009638-B02
Product Name:FEZ1 Antibody
Product Description:Mouse Polyclonal anti-FEZ1 - fasciculation and elongation protein zeta 1 (zygin I), MaxPab Antibody
Clonality:Polyclonal
ListPrice:295
Gene ID:9638
Gene Symbol:FEZ1
Immunogen:FEZ1 (1 a.a. ~ 392 a.a) full-length human protein.
Epitope:MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNA
KTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINE
EPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLD
QVEGAIRDFSEELVQQLA
Cross Reactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background:This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:Western Blot, ELISA
Species Summary:Hu
Package Size:0.05 ml
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human FEZ1 antibodies


2008©ExactAntigen home | browse | about