| request information: | |
| Catalog Code: | H00009628-A01 |
| Product Name: | RGS6 Antibody |
| Product Description: | Mouse Polyclonal anti-RGS6 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9628 |
| Gene Symbol: | RGS6 |
| Omim ID: | 603894 |
| Immunogen: | RGS6 (NP_004287, 207 a.a. ~ 307 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAES LIAYTEQYVEYDPLITPAEPS* |
| Specificity: | RGS6 - regulator of G-protein signalling 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-G protein signaling 6 regulator antibody, anti-GAP antibody, anti-GTPase activating protein antibody, anti-Regulator of G protein signaling 6 antibody, anti-S914 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |