| CatalogCode: | H00009627-M01 |
| ProductName: | SNCAIP Antibody |
| Product Description: | Mouse Monoclonal anti-SNCAIP (2A8) |
| Clone: | 2A8 |
| Clonality: | Monoclonal |
| Immunogen: | SNCAIP (NP_005451, 206 a.a. ~ 310 a.a) partial recombinant protein with GST tag. |
| Epitope: | PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGP* ... |
| Specificity: | SNCAIP - synuclein, alpha interacting protein (synphilin) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein containing several protein-protein interaction domains, including ankyrin-like repeats, a coiled-coil domain, and an ATP/GTP-binding motif. The encoded protein interacts with alpha-synuclein in neuronal tissue and may play a role in the formation of cytoplasmic inclusions and neurodegeneration. A mutation in this gene has been associated with Parkinson's disease. Alternatively spliced transcript variants encoding different isoforms of this gene have been described, but their full-length nature has yet to be determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-SYPH1 antibody |
| ProteinTarget: | SNCAIP - synuclein, alpha interacting protein (synphilin) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9627 |
| Gene_Symbol: | SNCAIP |
| Omim_ID: | 168,600,603,779 H00009627-B01 |
order or
more information: | company product webpage |
| request information: |
|