| request information: |
|
| Catalog Code: | H00009627-A01 |
| Product Name: | SNCAIP Antibody |
| Product Description: | Mouse Polyclonal anti-SNCAIP |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9627 |
| Gene Symbol: | SNCAIP |
| Immunogen: | SNCAIP (NP_005451, 206 a.a. ~ 310 a.a) partial recombinant protein with GST tag. |
| Epitope: | PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFH
LQSSAAESKPEEQVSGLNRTSSQGP* |
| Specificity: | SNCAIP - synuclein, alpha interacting protein (synphilin) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a protein containing several protein-protein interaction domains, including ankyrin-like repeats, a coiled-coil domain, and an ATP/GTP-binding motif. The encoded protein interacts with alpha-synuclein in neuronal tissue and may play a role in the formation of cytoplasmic inclusions and neurodegeneration. A mutation in this gene has been associated with Parkinson's disease. Alternatively spliced transcript variants encoding different isoforms of this gene have been described, but their full-length nature has yet to be determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SYPH1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |