ExactAntigen

AATK Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009625-M04
Product Type:Primary Antibody
Product Name:AATK Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9625
Host:Mouse
Clone:2C8
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-AATK (2C8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Bv, Ca, Hu, Po, Rt, Rb
Alternate Names:anti-AATYK antibody, anti-KIAA0641 antibody, anti-LMR1 antibody, anti-LMTK1 antibody
Immunogen:AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Epitope:SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG ...
Specificity:AATK - apoptosis-associated tyrosine kinase
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:AATK
Omim ID:605276,
see all human AATYK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about