| Catalog Code: | H00009625-M04 |
| Product Type: | Primary Antibody |
| Product Name: | AATK Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 9625 |
| Host: | Mouse |
| Clone: | 2C8 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-AATK (2C8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Bv, Ca, Hu, Po, Rt, Rb |
| Alternate Names: | anti-AATYK antibody, anti-KIAA0641 antibody, anti-LMR1 antibody, anti-LMTK1 antibody |
| Immunogen: | AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Epitope: | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG ... |
| Specificity: | AATK - apoptosis-associated tyrosine kinase |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | AATK |
| Omim ID: | 605276, |
|