ExactAntigen

Mouse Monoclonal anti-AATK (2D10)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00009625-M02
ProductName:AATK Antibody
Product Description:Mouse Monoclonal anti-AATK (2D10)
Clone:2D10
Clonality:Monoclonal
Immunogen:AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Epitope:SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG ...
Specificity:AATK - apoptosis-associated tyrosine kinase
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AATYK antibody, anti-KIAA0641 antibody, anti-LMR1 antibody, anti-LMTK1 antibody
ProteinTarget:AATK - apoptosis-associated tyrosine kinase
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:9625
Gene_Symbol:AATK
Omim_ID:605276,
see all human AATYK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about