| CatalogCode: | H00009625-M02 |
| ProductName: | AATK Antibody |
| Product Description: | Mouse Monoclonal anti-AATK (2D10) |
| Clone: | 2D10 |
| Clonality: | Monoclonal |
| Immunogen: | AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Epitope: | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG ... |
| Specificity: | AATK - apoptosis-associated tyrosine kinase |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AATYK antibody, anti-KIAA0641 antibody, anti-LMR1 antibody, anti-LMTK1 antibody |
| ProteinTarget: | AATK - apoptosis-associated tyrosine kinase |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9625 |
| Gene_Symbol: | AATK |
| Omim_ID: | 605276, |