| request information: |
|
| Catalog Code: | H00009619-M01 |
| Product Name: | ABCG1 Antibody |
| Product Description: | Mouse Monoclonal anti-ABCG1 (2E11) |
| Clone: | 2E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9619 |
| Gene Symbol: | ABCG1 |
| Omim ID: | 603076 |
| Immunogen: | Partial recombinant human protein with GST tag, between amino acids 21-130 [NCBI#AAH29158]. |
| Epitope: | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKT
LLKGISGKFNSGELVAIMGPSGAGKSTLMNI |
| Cross Reactivity: | Human. Other species have not been tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | This antibody is reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 lambda |
| Host Name: | Mouse |
| Buffer: | PBS, [pH7.2] |
| Application Summary: | ELISA, |
| Species Summary: | Hu , |
| Alternate Names: | anti-ABC8 antibody, anti-MGC34313 antibody, anti-WHITE1 antibody |
| Package Size: | 0.1 mg |
order or
more information: | company product webpage |