| request information: |
|
| Catalog Code: | H00009618-M01 |
| Product Name: | TRAF4 Antibody |
| Product Description: | Mouse Monoclonal anti-TRAF4 (3F6) |
| Clone: | 3F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9618 |
| Gene Symbol: | TRAF4 |
| Omim ID: | 602464 |
| Immunogen: | TRAF4 (AAH01769, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRN
YVRDDAVFIRAAVELPRKILS |
| Specificity: | TRAF4 - TNF receptor-associated factor 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CART1 antibody, anti-MLN62 antibody, anti-RNF83 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |