| request information: | |
| Catalog Code: | H00009612-A01 |
| Product Name: | NCOR2 Antibody |
| Product Description: | Mouse Polyclonal anti-NCOR2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9612 |
| Gene Symbol: | NCOR2 |
| Omim ID: | 600848 |
| Immunogen: | NCOR2 (NP_006303, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERS QELHLRPESHSYLPELGKSEMEFIESKRPRL* |
| Specificity: | NCOR2 - nuclear receptor co-repressor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CTG26 antibody, anti-SMRT antibody, anti-SMRTE antibody, anti-SMRTE-tau antibody, anti-TNRC14 antibody, anti-TRAC-1 antibody, anti-TRAC1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |