| request information: |
|
| Catalog Code: | H00009587-B01 |
| Product Name: | MAD2L1BP Antibody |
| Product Description: | Mouse Polyclonal anti-MAD2L1BP - MAD2L1 binding protein, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 9587 |
| Gene Symbol: | MAD2L1BP |
| Immunogen: | MAD2L1BP (AAH02904, 1 a.a. ~ 275 a.a) full-length human protein. |
| Epitope: | MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKH
IMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNA
LSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSR
GHKLTVTLSCGRPSIRTT |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence and ELISA. |
| Background: | The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA, immunofluorescence |
| Species Summary: | Hu |
| Alternate Names: | anti-CMT2 antibody, anti-KIAA0110 antibody, anti-MGC11282 antibody, anti-RP1-261G23.6 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |