| request information: |
|
| Catalog Code: | H00009586-M02 |
| Product Name: | CREB5 Antibody |
| Product Description: | Mouse Monoclonal anti-CREB5 (8A5) |
| Clone: | 8A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9586 |
| Gene Symbol: | CREB5 |
| Immunogen: | CREB5 (NP_001011666, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSN
PCASPQVQPMHSEAKMRLKA* |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Purity: | IgG purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Mu , Rt , |
| Alternate Names: | anti-cAMP responsive element binding protein 5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |