| request information: |
|
| Catalog Code: | H00009580-M01 |
| Product Name: | SOX13 Antibody |
| Product Description: | Mouse Monoclonal anti-SOX13 (3E8) |
| Clone: | 3E8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9580 |
| Gene Symbol: | SOX13 |
| Omim ID: | 604748, |
| Immunogen: | SOX13 (NP_005677, 25 a.a. ~ 139 a.a) partial recombinant protein with GST tag. |
| Epitope: | KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQ GNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNL KEVVPAIEKLLSSDWKERFLGRNSMEAKDV* |
| Specificity: | SOX13 - SRY (sex determining region Y)-box 13 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Nuclear |
| Background: | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ICA12 antibody, anti-Islet cell antigen 12 antibody, anti-MGC117216 antibody, anti-SOX 13 antibody, anti-SOX 13 protein antibody, anti-SOX13 protein antibody, anti-SRY (sex determining region Y) box 13 antibody, anti-SRY box containing gene 13 antibody, anti-SRY related HMG box gene 13 antibody, anti-Type 1 diabetes autoantigen antibody, anti-Type 1 diabetes autoantigen ICA 12 antibody, anti-Type 1 diabetes autoantigen ICA12 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |