| request information: |
|
| Catalog Code: | H00009573-M01 |
| Product Name: | GDF3 Antibody |
| Product Description: | Mouse Monoclonal anti-GDF3 (2B10) |
| Clone: | 2B10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9573 |
| Gene Symbol: | GDF3 |
| Omim ID: | 606522, |
| Immunogen: | GDF3 (NP_065685, 265 a.a. ~ 365 a.a) partial recombinant protein with GST tag. |
| Epitope: | HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQD
NNDNVILRHYEDMVVDECGCG* |
| Specificity: | GDF3 - growth differentiation factor 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |