| request information: |
|
| Catalog Code: | H00009573-B01 |
| Product Name: | GDF3 Antibody |
| Product Description: | Mouse Polyclonal anti-GDF3 - growth differentiation factor 3, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 9573 |
| Gene Symbol: | GDF3 |
| Immunogen: | GDF3 (NP_065685, 1 a.a. ~ 364 a.a) full-length human protein. |
| Epitope: | MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREAAATTGVSRDLCYVKELGVR
GNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKEREQLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQ
TTPKPGKMFVLRSVPWPQGAVHFNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVT
LNPDQCHPSRKRRAAIPV |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |