| request information: |
|
| Catalog Code: | H00009572-M02 |
| Product Name: | NR1D1 Antibody |
| Product Description: | Mouse Monoclonal anti-NR1D1 (4F6) |
| Clone: | 4F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9572 |
| Gene Symbol: | NR1D1 |
| Omim ID: | 602408, |
| Immunogen: | NR1D1 (AAH56148, 1 a.a. ~ 615 a.a) full length recombinant protein with GST tag. |
| Epitope: | MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDG
SPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRR
SIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPL
ETSPTQHPTPGPMGPSPP |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation, and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | protein A purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu , |
| Alternate Names: | anti-EAR1 antibody, anti-THRA1 antibody, anti-THRAL antibody, anti-ear-1 antibody, anti-hRev antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|