| request information: |
|
| Catalog Code: | H00009567-M01 |
| Product Name: | GTP binding protein 1 Antibody |
| Product Description: | Mouse Monoclonal anti-GTP binding protein 1 (1H1) |
| Clone: | 1H1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9567 |
| Gene Symbol: | GTPBP1 |
| Omim ID: | 602245, |
| Immunogen: | GTPBP1 (NP_004277, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. |
| Epitope: | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV* |
| Specificity: | GTP binding protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GP-1 antibody, anti-GP1 antibody, anti-HSPC018 antibody, anti-MGC20069 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |